PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009788345.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 510aa    MW: 56694.5 Da    PI: 4.5327
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009788345.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS341.11.9e-1041405021374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     lv+ Ll+c eav+ ++l+la+al+  ++e+a ++  +m+++a+yf+eAL +r+++   +l ++++ s  +     ++++    f+e+ P+l+f++
  XP_009788345.1 140 LVKILLACGEAVQRNNLALADALVRLIREHAVSEFGAMKKVATYFAEALDQRIQG--MNLEDIMEFSCYT-----DNIMQ-MRFHEIRPYLEFAY 226
                     6789***************************************************..4455545444443.....33333.35************ PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                        N+aIl+a+++++rvHiiDf+++qG QW+aL+q +a Rp+gpp +R+Tg+gsp+  ++++l++++++La+fA+++gv+fef+ +v+++l+d++
  XP_009788345.1 227 SSVNRAILDAFANSSRVHIIDFSLNQGPQWLALMQDFALRPGGPPAFRLTGIGSPD--NTDALRQLKWKLAEFANKFGVEFEFRGIVVDSLADVD 319
                     ******************************************************76..9************************************ PP

            GRAS 191 leeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres...e 280
                     +++L+++p   E +aVn++++ h+ll  ++++e+    vL+ +k++ Pk+v+++e+ea+   + F++rf +a +yys++f sle++ ++++   +
  XP_009788345.1 320 TSRLDIRPsnYEEVAVNSIFEFHHLLYTPGEIEK----VLNSIKEMHPKIVTIIEEEANQ--SVFMDRFNHAWSYYSKMFGSLENSESTHDqhnS 408
                     ********999***************99999999....*******************975..9********************776433333344 PP

            GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      ++ + +e+lg++i n+vace    +  ++tl++Wr ++++aGF+pv+l+ +++ qa ++l+ +k  +gyrve+++g+l+l W++rpL+s+S+W+
  XP_009788345.1 409 GDSRLVHEYLGQQINNMVACELGT-ELVETTLSEWRVKMNSAGFNPVQLGPSMYVQATMILALFKnRNGYRVEQNDGCLTLSWHGRPLISTSVWQ 502
                     555666667************887.5667789*********************************9****************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098549.863114481IPR005202Transcription factor GRAS
PfamPF035146.7E-102140502IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 510 aa     Download sequence    Send to blast
MSSGNSSSDK LLEDGESFDS TTDAIIYGTS DISDLTLSLI SDPNIPNSSD SSTSIDDHIS  60
TAAGGCDDMI VSSGATSRIF NSSTDFRAFS RNISVVCNNY SDKVAEEGSA ESSNRMRSRD  120
GLELCLGLRI GSEAVNEEPL VKILLACGEA VQRNNLALAD ALVRLIREHA VSEFGAMKKV  180
ATYFAEALDQ RIQGMNLEDI MEFSCYTDNI MQMRFHEIRP YLEFAYSSVN RAILDAFANS  240
SRVHIIDFSL NQGPQWLALM QDFALRPGGP PAFRLTGIGS PDNTDALRQL KWKLAEFANK  300
FGVEFEFRGI VVDSLADVDT SRLDIRPSNY EEVAVNSIFE FHHLLYTPGE IEKVLNSIKE  360
MHPKIVTIIE EEANQSVFMD RFNHAWSYYS KMFGSLENSE STHDQHNSGD SRLVHEYLGQ  420
QINNMVACEL GTELVETTLS EWRVKMNSAG FNPVQLGPSM YVQATMILAL FKNRNGYRVE  480
QNDGCLTLSW HGRPLISTSV WQLTPPPSLG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-461395023375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0488711e-171EU048871.1 Nicotiana tabacum isolate SSAP gp91tr retrotransposon Tnt1, flanking sequence and LTR.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009788345.10.0PREDICTED: DELLA protein GAI-like
SwissprotQ7Y1B61e-146GAI_SOLLC; DELLA protein GAI
TrEMBLK4D4701e-156K4D470_SOLLC; Uncharacterized protein
STRINGSolyc10g086380.1.11e-155(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1696445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.11e-126GRAS family protein